Leu30-Thr211, with C-terminal 8*His LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTGGGSHHHHHHHH
28-38kDa (Reducing)
>95% by SDS-PAGE
PBS, pH7.4
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
TNFR-1 is a member of the TNF receptor superfamily of proteins which is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Binding of membrane-bound tumor necrosis factor alpha to the membrane-bound receptor induces receptor trimerization and activation, which plays a role in cell survival, apoptosis, and inflammation. Proteolytic processing of the encoded receptor results in release of the soluble form of the receptor, which can interact with free tumor necrosis factor alpha to inhibit inflammation. Mice lacking a functional copy of this gene exhibit impaired immune function.
Anti-His antibody Immobilized on CM5 Chip captured TNFR-1/CD120a His Tag, Human (Cat. No. UA040028), can bind TNF-α, Human (Cat. No. UA040005) with an affinity constant of 0.106nM as determined in SPR assay.
Anti-His antibody Immobilized on CM5 Chip captured TNFR-1/CD120a His Tag, Human (Cat. No. UA040028), can bind TNF-α, Human (Cat. No. UA040018) with an affinity constant of 0.23 nM as determined in SPR assay.
Anti-His antibody Immobilized on CM5 Chip captured TNFR-1/CD120a His Tag, Human (Cat. No. UA040028), can bind TNF-α(80-235aa), Mouse (Cat. No. UA040059) with an affinity constant of 1.24 nM as determined in SPR assay.
您现在的位置：
