Protein sequence (XP_008266192.1, His18-Arg150, with C-His tag) HKSSSKGQDRYMIRMHQLLDIVDQLQSDVNDLDPDFLPAPQDVQKGCEQSAFSCFQKAQLKPANAGDNGKRISSLIKQLKRKLPSTKSKKTQKHRPTCPSCYSYEKKNLKEFLERLKSLIQKMIHQHLLEHLR
12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.
Interleukin 21 (IL-21) is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. IL-21 is noted to have anti-tumour effects through continued and increased CD8+ cell response to achieve enduring tumor immunity. IL-21 may contribute to the mechanism by which CD4+ T helper cells orchestrate the immune system response to viral infections. In HIV infected subjects, IL-21 has been reported to critically improve the HIV-specific cytotoxic T cell responses and NK cell functions. IL-21 was approved for Phase 1 clinical trials in metastatic melanoma (MM) and renal cell carcinoma (RCC) patients. IL-21 proceeded to Phase 2 clinical trials where it was administered alone or coupled with drugs as sorafinib and rituximab.
2μg（R: reducing conditions）
您现在的位置：
