Protein sequence(Q9H293, Tyr33-Gly177, with C-10*His) YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGGGGGSHHHHHHHHHH
12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.
Interleukin-25 (IL-25) – also known as interleukin-17E (IL-17E) – is a protein that in humans is encoded by the IL25 gene on chromosome 14. IL-25 is produced by many cell types. This cytokine can induce NF-κB activation, and stimulate the production of IL-8 (named also CXCL8), which is the major chemotactic substance of neutrophils. Another important function of interleukin 25 is to support the Th2 immune response. IL-25 has been shown to induce the production of IL-4, IL-5 and IL-13. Because IL-25 promotes the development of a Th2 immune response, it acts to protect against several bowel infections caused by helminths. IL-25 is also referred to as the regulator of IL-9 production. Another function of IL-25 is the activation of natural lymphoid cells 2 (ILC2).
Immobilized Human IL-25, His tag at 4 μg/mL (50 μL/well) can bind Recombinant Human IL-17RB (C-Fc) with EC50 of 0.129-0.142 μg/ ml.
RP-367_IL-25_Q9H293
您现在的位置：
