Protein sequence(P02753, Glu19-Leu201, with C-10*His) ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLGGGGSHHHHHHHHHH
＞90% by SDS-PAGE
12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.
Retinol binding protein 4, also known as RBP4, is a transporter protein[5] for retinol (vitamin A alcohol). It is mainly, though not exclusively, synthesized in the liver and circulates in the bloodstream as a hepatokine bound to retinol in a complex with transthyretin. RBP4 has been a drug target for ophthalmology research due to its role in vision. RBP4 may also be involved in metabolic diseases as suggested by recent studies. Retinol-binding protein 4 in urine (uRBP4) is a functional biomarker of disease of the proximal renal tubule1. When proximal tubular dysfunction interferes with reabsorption of proteins filtered by the renal glomerulus, striking increases of uRBP4 are found.
Immobilized Human RBP4, His tag at 1 μg/mL (50 μL/well) can bind RBP4 Recombinant Rabbit mAb (S-693-111) (Cat. No. S0B0605) with EC50 of 3.388-3.785 ng/ ml.
2μg（R: reducing conditions）
您现在的位置：
