Protein sequence(P60033, Phe113-Lys201, with C-10*His) FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH
12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.
CD81 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. It is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Studies showed that this protein plays a critical role in Hepatitis C attachment and/or cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. It also appears to play a role in liver invasion by Plasmodium species. Meanwhile, CD81 is required for Plasmodium vivax sporozoite entry into human hepatocytes and for Plasmodium yoelii sporozoite entry into murine hepatocytes.
Immobilized Human CD81, His Tag at 2 μg/mL (50 μL/well) can bind CD81 Recombinant Rabbit mAb (SDT-144-22) (S0B0053) with EC50 of 18.68-24.35 ng/ml.
2μg（R: reducing conditions）
您现在的位置：
