Protein sequence(P05231, Val30-Met212, with C-10*His)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH
Theoretical: 22.4kDa Actual: 22-23kDa
＞95% by SDS-PAGE
12 months from date of receipt, -20 ℃ to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
Interleukin 6 (IL-6) is a prototypical cytokine for maintaining homeostasis. When homeostasis is disrupted by infections or tissue injuries, IL-6 is produced immediately and contributes to host defense against such emergent stress through activation of acute-phase and immune responses. However, dysregulated excessive and persistent synthesis of IL-6 has a pathological effect on, respectively, acute systemic inflammatory response syndrome and chronic immune-mediated diseases.
The ELISA based assay shows that Human IL-6, His tag is stable at 4°C for 4 weeks.
Immobilized Human IL-6, His tag at 4 μg/mL (50 μL/well) can bind IL-6R alpha/CD126 Fc Chimera, Human (UA010448) with EC50 of 9.425-12.74 ng/ml.
The ELISA based assay shows that Human IL-6, His tag is stable after freezing and thawing 3 times.
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.2-0.9 ng/mL.
您现在的位置：
