Protein sequence (P01344, Ala25-Glu91, with N-hFc tag) AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Predicted MW: 34.6 kDa Observed MW: 40 kDa
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
Insulin-like growth factor 2 (IGF-2) is one of three protein hormones that share structural similarity to insulin. It has growth-regulating, insulin-like and mitogenic activities. It is believed to be a major fetal growth factor. The major role of IGF-2 is as a growth promoting hormone during gestation. IGF-2 exerts its effects by binding to the IGF-1 receptor and to the short isoform of the insulin receptor (IR-A or exon 11-). IGF-2 may also bind to the IGF-2 receptor (also called the cation-independent mannose 6-phosphate receptor), which acts as a signalling antagonist. IGF-2 acts as a co-hormone together with both FSH and LH. IGF-2 is sometimes produced in excess in islet cell tumors and non-islet hypoglycemic cell tumors, causing hypoglycemia. Loss of imprinting of IGF-2 is a common feature in tumors seen in Beckwith-Wiedemann syndrome. As IGF-2 promotes development of fetal pancreatic beta cells, it is believed to be related to some forms of diabetes mellitus.
Immobilized Human IGFBP-4, His tag (Cat. No. S0A6002) at 2 μg/mL (50 μL/well) can bind Human IGF-2 Protein, hFc Tag with EC50 of 39.02-43.08 ng/ml.
2 μg（R: reducing conditions）
您现在的位置：
