Protein sequence (P02976, Met212-Lys269, with C-His tag) MADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
Protein A is a 42 kDa surface protein originally found in the cell wall of the bacteria Staphylococcus aureus. It is encoded by the spa gene and its regulation is controlled by DNA topology, cellular osmolarity, and a two-component system called ArlS-ArlR. It has found use in biochemical research because of its ability to bind immunoglobulins. It is composed of five homologous Ig-binding domains that fold into a three-helix bundle. Each domain is able to bind proteins from many mammalian species, most notably IgGs. It binds the heavy chain within the Fc region of most immunoglobulins and also within the Fab region in the case of the human VH3 family. Through these interactions in serum, where IgG molecules are bound in the wrong orientation (in relation to normal antibody function), the bacteria disrupts opsonization and phagocytosis.
Immobilized Human IgG1 Fc (Cat. No. S0A0052) at 4 μg/mL (50 μL/well) can bind Staphylococcus aureus Protein A (B), His tag with EC50 of 7.864-9.985 ng/ ml.
Immobilized Human IgG2 Fc (Cat. No. S0A0053) at 20 μg/mL (50 μL/well) can bind Staphylococcus aureus Protein A (B), His tag with EC50 of 12.95-15.57 ng/ ml.
2 μg(R: reducing conditions)