Protein sequence (O43653, Leu12-Ser86, with C-hFc tag) LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
Prostate stem cell antigen is a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. It is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. The ligand activating PSCA or the downstream physiological role has not yet been determined, because of its mechanism and over expression in prostate cancer cells, PSCA can potentially serve as a biomarker for detecting cancer.
2μg(R: reducing conditions)