Protein sequence (P10749, Val118-Ser269, with N-His tag) VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
IL-1β is a member of the interleukin 1 family of cytokines. This cytokine is produced by activated macrophages, monocytes, and a subset of dendritic cells known as slanDC, as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. IL-1β, in combination with IL-23, induced expression of IL-17, IL-21 and IL-22 by γδ T cells. Increased production of IL-1β causes a number of different autoinflammatory syndromes, most notably the monogenic conditions referred to as Cryopyrin-Associated Periodic Syndromes (CAPS). Intestinal dysbiosis has been observed to induce osteomyelitis through a IL-1β dependent manner.
Immobilized Mouse IL-1 beta/IL-1F2 Protein, His tag at 2 μg/mL (100 μL/well) can bind Human IL-1R2/CD121b Protein, hFc tag (Cat. No. S0A1129) with EC50 of 10.5-15.3 ng/ml.
2μg（R: reducing conditions）
您现在的位置：