Protein sequence (Q5UBV8, Ile76-Leu252, with N-His tag) ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
Tnfsf15, also known as tumor necrosis factor - like weak inducer of apoptosis (TWEAK), is a member of the tumor necrosis factor (TNF) superfamily. It is a type II transmembrane protein that can be cleaved to release a soluble form. Tnfsf15 plays important roles in various physiological and pathological processes. It regulates cell survival, proliferation, and migration by binding to its receptor, Fn14. In the immune system, Tnfsf15 is involved in inflammation and immune cell activation. It also participates in tissue remodeling and angiogenesis. Dysregulation of Tnfsf15 has been associated with several diseases, including cancer, autoimmune diseases, and cardiovascular diseases.
2μg(R: reducing conditions)