Protein sequence (O15123, Asp68-Phe496, with C-His tag) DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Predicted MW: 51 kDa Observed MW: 72 kDa
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
Angiopoietin - 2 (ANGPT2) is a significant protein in the angiopoietin family. It plays a crucial role in angiogenesis, the process of new blood vessel formation. ANGPT2 is produced by endothelial cells and acts as a key regulator in vascular remodeling. Functionally, ANGPT2 binds to the Tie2 receptor on endothelial cells. In the presence of vascular endothelial growth factor (VEGF), ANGPT2 promotes endothelial cell destabilization, leading to increased vascular permeability and facilitating angiogenesis. However, in the absence of VEGF, it can cause vessel regression. Abnormal levels of ANGPT2 have been linked to various pathological conditions. In cancer, elevated ANGPT2 often correlates with tumor angiogenesis and metastasis, as tumors rely on new blood vessels for growth and spread. Additionally, it is involved in inflammatory diseases and eye disorders related to abnormal blood vessel growth, making it an important target for research into novel therapies.
Immobilized Human ANGPT2 Protein, His tag at 2 μg/mL (100 μL/well) can bind Tie-2 Fc Chimera, Cynomolgus (Cat. No. UA010526) with EC50 of 0.07-0.15 μg/ml.
2μg（R: reducing conditions）
您现在的位置：