Protein sequence (P78556, Ala27-Met96, with N-hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Predicted MW: 35 kDa Observed MW: 35 kDa
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
CCL20, also known as macrophage inflammatory protein 3-alpha (MIP-3α), is a small cytokine belonging to the CC chemokine family. It plays a crucial role in the immune system. CCL20 is mainly produced by activated macrophages, dendritic cells, and epithelial cells in response to various stimuli such as inflammatory cytokines and microbial products. This protein exerts its function by binding to its specific receptor CCR6. The CCL20-CCR6 axis is involved in the recruitment of immune cells to the sites of inflammation, thereby contributing to both innate and adaptive immune responses. Dysregulation of CCL20 has been associated with several diseases, including autoimmune disorders and certain types of cancers, making it a potential therapeutic target for drug development.
2μg（R: reducing conditions）
您现在的位置：
