MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
11.8kDa(Reducing)
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
· 12 months from date of receipt, -20 to -70 °C as supplied.
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
1. Nedelkoska, L., and Benjamins, J.A., Binding of cholera toxin B subunit: a surface marker for murine microglia but not oligodendrocytes or astrocytes. J. Neurosci. Res., 53, 605-612 (1998).
2. Janes, P.W., et al., Aggregation of lipid rafts accompanies signaling via the T cell antigen receptor. J. Cell Biol., 147, 447-461 (1999).
Cholera toxin （CTB）belongs to the AB5 –subunit family oftoxins.The native hexameric protein has a molecular mass of ~85 kDa and contains two subunits. It consists of a single A subunit (~27.2 kDa), responsible for the ADP-ribosylation activity, and five B subunits(~11.6 kDa each), which are arranged as a pentameric ring with an apparent 5-fold symmetry and are associated with the cell surface receptor binding and subsequent internalization (transmembrane transport)of the enzymatic component.
您现在的位置：