Ser21-Asn132, with N-terminal 8*His HHHHHHHHGGGSSPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN
25-40kDa
PBS, pH7.4
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
1. Comparative Study Protein Expr Purif . 1998 Mar;12(2):239-48.
Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. Interleukin 13 is a single-chain glycosylated polypeptide, which belongs to the IL-13/IL-4 family. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4Rα) and at least one of two known IL-13-specific binding chains. Recent studies have shown that human interleukin-13 has many structural similarities with human interleukin-4 and is produced by gene replication events. As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases.Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity.
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells, the EC50 for this effect is less than 5ng/ml.
1μg (R: reducing condition, N: non-reducing condition).
CM5 Chip captured IL-13RA1 His Tag Protein, Cynomolgus (Cat. No. UA011075), can bind IL-13 Protein, Cynomolgus (Cat. No. UA040112) with an affinity constant of 42.89nM as determined in SPR assay.
您现在的位置：
