Gln27-Ser220, with C-terminal 8*His Tag QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSGGGSHHHHHHHH
1. Shannon L McArdel. Roles of CD48 in regulating immunity and tolerance. Clin Immunol. 2016 Mar; 164:10-20.Epub 2016 Jan 18.
CD48, a member of the signaling lymphocyte activation molecule family, participates in adhesion and activation of immune cells. Although constitutively expressed on most hematopoietic cells, CD48 is upregulated on subsets of activated cells. CD48 can have activating roles on T cells, antigen presenting cells and granulocytes, by binding to CD2 or bacterial FimH, and through cell intrinsic effects. Interactions between CD48 and its high affinity ligand CD244 are more complex, with both stimulatory and inhibitory outcomes. CD244:CD48 interactions regulate target cell lysis by NK cells and CTLs, which are important for viral clearance and regulation of effector/memory T cell generation and survival.
1μg (R: reducing condition, N: non-reducing condition).
Immobilized CD48 His Tag, Human (Cat. No. UA010595) at 2.0μg/mL (100μL/well) can bind 2B4/CD244 Fc Chimera, Human(Cat. No. UA010890) with EC50 of 36.94-47.14 ng/mL.
Protein A Chip captured 2B4/CD244 Fc Chimera, Human (Cat. No. UA010890), can bind CD48 His Tag, Human(Cat. No. UA010595) with an affinity constant of 17.70nM as determined in SPR assay.
您现在的位置：