Pro166-Ser406, with C-terminal 8*His PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAASGGGSHHHHHHHH
35-42 kDa(Reducing)
＞95% by SDS-PAGE
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Angiopoietin-like 4 (ANGPTL4) is also known as , ARP4, PGAR. ANGPTL4 contains one fibrinogen C-terminal domain. ANGPTL4 is a homooligomer, and the homooligomer undergoes proteolytic processing to release its carboxyl fibrinogen-like domain, which circulates as a monomer. The homooligomer unprocessed form is able to interact with the extracellular matrix. ANGPTL4 may act as a regulator of angiogenesis and modulate tumorigenesis. ANGPTL4 inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. ANGPTL4 may exert a protective function on endothelial cells through an endocrine action.
Immobilized Angiopoietin-like 4/ANGPTL4 His Tag, Human (Cat. No. UA010056) at 2.0μg/mL (100μL/well) can bind LILRB2/CD85d/ILT4 Fc Chimera, Human (Cat. No. UA010037) with EC50 of 0.087-0.14 μg/mL.
Protein A Chip captured LILRB2/CD85d/ILT4 Fc Chimera, Human (Cat. No. UA010037), can bind Angiopoietin-like 4/ANGPTL4 His Tag, Human (Cat. No. UA010056) with an affinity constant of 30.72nM as determined in SPR assay.
您现在的位置：