Gly23-Ala342, with C-terminal 8*His GQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALAGGGSHHHHHHHH
1. Review Invest Clin . 2010 Jun;51(2):257-68.
RAGE(Receptor for Advanced glycosylation End Products) is a 35kD transmembrane receptor of the immunoglobulin superfamily. It is also called AGER. Its name comes from its ability to bind advanced glycation endproducts (AGE), which include chiefly glycoproteins the glycans of which have been modified non-enzymatically through the Maillard reaction. RAGE represents an important factor in innate immunity against pathogens, but it also interacts with endogenous ligands, resulting in chronic inflammation. Studies have demonstrated the role of RAGE in inflammatory cell recruitment and leukocyte extravasation across the endothelial barrier.
1μg (R: reducing conditions, N: non-reducing conditions).