Trp21-Asn343, with C-terminal 6*His WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNHHHHHH
CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic viro therapy. More intriguingly, PVR participates in a considerable number of immunoregulatory functions through its interactions with activating and inhibitory immune cell receptors. These functions are often modified in the tumor microenvironment, contributing to tumor immunosuppression.
Immobilized CD155/PVR His Tag, Human (Cat. No. UA010069) at 2.0μg/mL (100μL/well) can bind DNAM-1/CD226 Fc Chimera, Human (Cat. No. UA010560) with EC50 of 4.48-13.43μg/ml.
Anti-His antibody Immobilized on CM5 Chip captured CD155/PVR His Tag, Human (Cat. No. UA010069), can bind TIGIT Fc Chimera, Human (Cat. No. UA010011) with an affinity constant of 11.44nM as determined in SPR assay.
Protein A Chip captured
DNAM-1/CD226 Fc Chimera, Human(Cat. No. UA010560), can bind CD155/PVR His Tag,
Human(Cat. No. UA010069) with an affinity constant of 1.28μM as determined in
SPR assay.
您现在的位置：