Ser24-Gln159 with C terminal 8*His
MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH
1. J Allergy Clin Immunol. 2023 Jul 13;S0091-6749(23)00888-6. Online ahead of print.
2. Allergy. 2023 Jul 13. Online ahead of print.
3. Clin Exp Med. 2023 Jul 1. Online ahead of print.
IL-31 which produced by activated Th2-type T cells. IL-31 signals through a receptor composed of IL-31 receptor A and oncostatin M receptor. IL-31 activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL-31 has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. Patients with atopic dermatitis, chronic spontaneous urticaria, allergic contact dermatitis, prurigo nodularis, primary cutaneous lymphoma and mastocytosis exhibit increased serum levels of IL-31 protein and elevated IL-31 mRNA in the skin.
Dose-dependent changes in STAT3 phosphorylation by DH-82 cells in response to Recombinant Canine IL-31 His,The EC50 for this effect is 80- 200ng/mL in the presence of 20ng/mL Recombinant Canine IFN-γ.
1μg ( R: reducing condition, N: non-reducing condition).
Measured by its binding ability in a functional ELISA. When Recombinant Canine IL-31 His Tag is immobilized 2.5µg/mL (100µL/well), Recombinant Canine OSMR Fc Chimera binds with an EC50 of 0.02-0.04μg/ml.
Measured by its binding ability in a functional ELISA. When Recombinant Canine OSMR Fc Chimera is immobilized 2.5µg/mL (100µL/well), Recombinant Canine IL-31 His tag binds with an EC50 of 1.2-1.4μg/ml.
您现在的位置：
