Ser19-Thr134, with C-terminal 8*His SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTGGGSHHHHHHHH
25-35kDa
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
1、Olsen O E. et al. (2020) Activins as Dual Specificity TGF-β Family Molecules: SMAD-Activation via Activin- and BMP-Type 1 Receptors. Biomolecules. 10(4): 519.
Activin proteins that belong to the transforming growth factor-beta (TGF-β) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.
CM5 Chip captured Activin A Protein, Human/Mouse/Rat (Cat. No. UA040343), can bind ACVR2B His Tag, Mouse (Cat. No. UA010246) with an affinity constant of 0.50μM as determined in SPR assay.
CM5 Chip captured Activin A Protein, Human (Cat. No. UA040178), can bind ACVR2B His Tag, Mouse (Cat. No. UA010246) with an affinity constant of 0.43μM as determined in SPR assay.
您现在的位置：