Ser21-Ala146, with C-terminal 8*His SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAGGGSHHHHHHHH
17-25kDa (Reducing)
>95% by SDS-PAGE
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
The R-Spondin proteins comprise a family of secreted proteins, known for their important roles in cell proliferation, differentiation and death, by inducing the Wnt pathway. Several studies have demonstrated the importance of RSPOs in regulation of a number of tissue-specific processes, namely: bone formation, skeletal muscle tissue development, proliferation of pancreatic β-cells and intestinal stem cells and even cancer. RSPO1 stands out among RSPOs molecules with respect to its potential therapeutic use, especially in the Regenerative Medicine field,due to its mitogenic activity in stem cells. Here, we generated a recombinant human RSPO1 (rhRSPO1) using the HEK293 cell line, obtaining a purified, characterized and biologically active protein product to be used in Cell Therapy.
Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells.
The EC50 for this effect is less than 20ng/mL in the presence of 5ng/mL Recombinant Human Wnt‑3a.
RNF43 mFc Chimera, Mouse (Cat. No. UA010216) captured on Protein A Biosenor, can bind RSPO1(21-146) His Tag, Human (Cat. No. UA040022) with an affinity constant of 6.73nM as determined in SPR assay.
您现在的位置：