Gln19-Lys140, with C-terminal hIgG1 Fc QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
1、Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135.
2、Oldenborg P A. (2004) Role of CD47 in erythroid cells and in autoimmunity. Leuk Lymphoma. 45(7): 1319-1327.
3、Kaczorowski D J. et al. (2007) Targeting CD47: NO limit on therapeutic potential. Circ Res. 100(5): 602-603.
CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with Sirp-α and Sirp-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.
Protein A Chip captured CD47 Fc Chimera, Mouse(Cat. No. UA010266), can bind SIRP-α/CD172A His Tag, Mouse(Cat. No. UA010619) with an affinity constant of 0.70μM as determined in SPR assay.
Immobilized SIRP-α/CD172A His Tag, Mouse (Cat. No. UA010619) at 2.0μg/mL (100μL/well) can bind CD47 Fc Chimera, Mouse (Cat. No. UA010266) with EC50 of 0.070-0.10 μg/ml.
Immobilized SIRP-α/CD172a His Tag, Rat (Cat. No. UA010780) at 2.0μg/mL (100μL/well) can bind CD47 Fc Chimera, Mouse (Cat. No. UA010266) with EC50 of 51.28-62.15 ng/mL.
您现在的位置：