Thr36-Ser242, with C-terminal 8*His TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASGGGSHHHHHHHH
33-55kDa
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
1.Tchoupa, A.K. et al. (2014) Cell Commun. Signal. 12:27.
Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM-7), also known as CGM2, is an approximately 40 kDa GPI-anchored glycoprotein in the CEACAM family of adhesion molecules. Mature human CEACAM-7 consists of two Ig-like domains followed by the GPI anchor. Alternative splicing generates a short isoform that lacks the second Ig-like domain. CEACAM-7 is preferentially expressed on the luminal surface of epithelial cells near the mouth of colonic crypts and on pancreatic ductal epithelial cells. It is down-regulated during colorectal adeno
2μg (R: reducing condition, N: non-reducing condition).
Immobilized CEACAM-7 His Tag Protein, Human (Cat. No. UA010637) at 2.0μg/mL (100μL/well) can bind CEACAM-3/CD66d Fc Chimera Protein, Human (Cat. No. UA010277) with EC50 of 17.41-29.47ng/mL.