Phe29-Ala258, with C-terminal 8*His FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGGGSHHHHHHHH
43-55kDa (Reducing)
>95% by SDS-PAGE
PBS, pH7.4
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
V-set domain-containing T-cell activation inhibitor 1 (VTCN1) is also known as Immune costimulatory protein B7-H4, Protein B7S1, T-cell costimulatory molecule B7x, B7H4, which belongs to the immunoglobulin superfamily and BTN/MOG family. VTCN1 contains two Ig-like V-type (immunoglobulin-like) domains. The expression of VTCN1 is up-regulated by IL6 and IL10 and is inhibited by GM-CSF and IL4 on antigen-presenting cells (APCs). VTCN1/B7-H4 negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. VTCN1 involved in promoting epithelial cell transformation.
Immobilized B7-H4 His Tag Protein, Human (Cat. No. UA010121) at 2μg/mL (100μL/well) can bind S-RMab® B7-H4 Recombinant Rabbit mAb (SDT-1408-111) (Cat. No. S0B2356) with EC50 of 1.53-1.70 ng/ml.
您现在的位置：