Lys35-Ala685, with C-terminal 10*His KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGGGSGGGSHHHHHHHHHH
95-150kDa
PBS, pH7.4
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
1、Hammarstrom S. (1999). The carcinoembryonic antigen (CEA) family: structures, suggested functions and expression in normal and malignant tissues. Seminars in Cancer Biology. 9(2): 67-81.
The human CEA family has been fully characterized. It comprises 29 genes of which 18 are expressed; 7 belonging to the CEA subgroup and 11 to the pregnancy specific glycoprotein subgroup. CEA is an important tumor marker for colorectal and some other carcinomas. The CEA subgroup members are cell membrane associated and show a complex expression pattern in normal and cancerous tissues with notably CEA showing a selective epithelial expression. Several CEA subgroup members possess cell adhesion properties and the primordial member, biliary glycoprotein, seems to function in signal transduction or regulation of signal transduction possibly in association with other CEA sub-family members.
2e5 of transient transfected anti-CEACAM-5 ScFv CAR-293 cells were stained with 0.1ug CEACAM-5/CD66e His Tag Protein, Human, (Cat. No. UA010288) and His tag Recombinant Rabbit mAb and unrelated protein (Fig. C and B and D), and non-transfected 293 cells were used as a control (Fig. A). Alexa Fluor® 647 signal was used to evaluate the binding activity.
2e5 of transient transfected anti-CEACAM-5 ScFv CAR-293 cells were stained with isotype and Whitlow/218 Linker-Alexa Fluor® 488 (Fig. F and E). Alexa Fluor® 488 signal was used to evaluate the binding activity.
Immobilized CEACAM-5/CD66e His Tag, Human (Cat. No. UA010288) at 2.0μg/mL (100μL/well) can bind Anti-Human CEA Monoclonal Antibody (Labetuzumab) with EC50 of 1.81-2.15ng/mL.
您现在的位置：