Thr25-Ser232, with C-terminal 8*His & Avi Tag TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGGGSHHHHHHHHGLNDIFEAQKIEWHE
1、Senol S. et al. (2015) Folate receptor α expression and significance in endometrioid endometrium carcinoma and endometrial hyperplasia. International Journal of Clinical and Experimental Pathology. 8(5): 5633-5641.
Folate Receptor 1 (FOLR1), also known as Folate Receptor alpha and Folate Binding Protein (FBP), is a 37-42 kDa protein that mediates the cellular uptake of folic acid and reduced folates. FOLR1 is predominantly expressed on epithelial cells and is dramatically upregulated on many carcinomas. Mature FOLR1 is an N-glycosylated protein that is anchored to the cell surface by a GPI linkage. FOLR1 is internalized to the endosomal system where it dissociates from its ligand before recycling to the cell surface. The soluble form of FOLR1 can be shed from the cell surface and into serum and breast milk through protein hydrolysis.
Immobilized Folic Acid-BSA at 2.0μg/mL (100μL/well) can bind Biotinylated FOLR1 His&Avi Tag, Mouse (Cat. No. UA010437) with EC50 of 0.17-0.19μg/mL .