Gln19-Lys140, with C-terminal 8*His
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSHHHHHHHH
>95% by SDS-PAGE
1.Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135.
CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with SIRP-α and SIRP-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.
Immobilized CD47 His Tag, Mouse (Cat. No. UA010446) at 2.0μg/mL (100μL/well) can bind SIRP-α/CD172A Fc Chimera, Mouse (Cat. No. UA010647) with EC50 of 27.10-36.13ng/mL .
Protein A Chip captured SIRP-α/CD172A Fc Chimera, Mouse(Cat. No. UA010647), can bind CD47 His Tag, Mouse (Cat. No. UA010446) with an affinity constant of 1.56μM as determined in SPR assay.
您现在的位置：