Gly29-Gly153, with C-terminal 8*His
GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGGGGSHHHHHHHH
19-22kDa (Reducing)
>95% by SDS-PAGE
PBS, pH7.4
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
1. Reindl, M. et al. (2013) Nat. Rev.Neurol. 9:455.
Myelin oligodendrocyte glycoprotein (MOG) is a transmembrane protein belonging to immunoglobulin superfamily. Mouse MOG is synthesized with a 28 amino acid (aa) signal sequence, a 128 aa extracellular domain (ECD) containing an Ig-like domain, a 21 aa transmembrane domain, and a 69 aa cytosolic fragment featuring a hydrophobic domain that associates with the cytoplasmic face of the plasma membrane. MOG is expressed exclusively by oligodendrocytes in the central nervous system (CNS) and is localized to the outer layer of the myelin sheath as well as in the oligodendrocyte plasma membrane. This makes MOG a potential target of cellular and humoral immune responses in inflammatory demyelinating diseases.
Immobilized MOG His Tag Protein, Mouse (Cat. No. UA010433) at 2.0μg/mL (100μL/well) can bind Myelin Oligodendrocyte Glycoprotein (MOG) Recombinant Rabbit mAb (S-1384-61) (Cat. No. S0B0812) with EC50 of 0.92-1.16ng/mL.