Gln31-Gly232, with C-terminal 8*His
QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGGGGSHHHHHHHH
1.Barclay A.N., Wright G.J., Brooke G., Brown M.H.CD200 and membrane protein interactions in the control of myeloid cells. TrendsImmunol. 2002;23:285–290.
2.Wright G.J., Puklavec M.J., Willis A.C., HoekR.M., Sedgwick J.D., Brown M.H., Barclay A.N. Lymphoid/Neuronal cell surfaceOX2 glycoprotein recognizes a novel receptor on macrophages implicated in thecontrol of their function. Immunity. 2000;13:233–242.
3.Moreaux J., Veyrune J.L., Reme T., De Vos J.,Klein B. CD200, A putative therapeutic target in cancer. Biochem. Biophys. Res.Commun. 2008;366:117–122.
4.Barclay A.N. Different reticular elements in ratlymphoid tissue identified by localization of IA, Thy-1 and MRC OX-2 antigens.Immunology. 1981;44:727–736.
CD200 is a type-1 cell membrane glycoprotein of the immunoglobulin supergene family, present on both cells with myeloid/lymphoid origin as well as on epithelial cells and many cancer cells. CD200, also known as MRC OX-2, is a highly conserved, 48 kDa type 1a transmembrane glycoprotein related structurally to the B7 family of costimulatory receptors.The molecule itself consists of an IgSF extracellular domain (single V + C), a single transmembrane region and a short cytoplasmic tail lacking signaling motifs. The molecule is expressed by resting dendritic cells, thymocytes, endothelial cells, neurons and osteoblast precursors (OBp), as well as by activated B and T cells (including αβTCR+ and most γδTCR+ cells). CD200 interacts with a structurally related receptor (CD200R) expressed mainly on myeloid cells and is involved in regulation of macrophage and mast cell function. OX-2 / CD200 and CD200R associate via their respective N-terminal Ig-like domains. CD200 also plays an important role in prevention of graft rejection, autoimmune diseases and spontaneous abortion.
Protein A Chip captured CD200R Fc Chimera, Mouse (Cat. No. UA010546), can bind CD200 His Tag, Mouse (Cat. No. UA010491) with an affinity constant of 0.52μM as determined in SPR assay.
您现在的位置：