Glu28-Trp79, with N-terminal Human IgG Fc
PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGREQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW
1.Feng, S. et al. (2000) Am J. Pathol.156:1253.
TNFRSF12A was initially identified as a fibroblast growth factor-1-inducible gene in murine NIH 3T3 cells, and was named as fibroblast growth factor-inducible-14 (Fn14) gene. Human TNFRSF12A was cloned from a HUVEC cDNA library and identified as the TWEAK receptor and a member of the TNFR family. TNFRSF12A is highly expressed in heart, placenta and kidney. TNFRSF12A / FN14 promotes angiogenesis and the proliferation of endothelial cells. TNFRSF12A and its ligand play a key role in muscle atrophy, cerebral ischemia, kidney injury, atherosclerosis, experimental autoimmune encephalitis, rheumatoid arthritis, and inflammatory bowel disease.