Lys195-His352 HHHHHHHHKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
1.Nishioka K, et al.(2002) PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.Mol Cell.Jun;9(6):1201-13.
2. Jia Fang et al. (2002)Purification and functional characterization of SET8, a nucleosomal histone H4-lysine 20-specific methyltransferase. Curr Biol. 2002 Jul 9;12(13):1086-99.
KMT5A (SETD8/Pr-SET7/KMT5A) is an important member of the methyltransferase family. It is a specific single methyltransferase of histone lysine H4K20 and participates in a variety of biological processes such as transcriptional regulation, cell cycle regulation, DNA damage. Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Especially monomethylates 'Lys-20' of histone H4 (H4K20me1). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional inhibition. It mainly plays a role in the euchromatin region, thus playing a central role in the euchromatic gene silencing.
您现在的位置：
