Ala46-Pro217, with C-terminal Avi&His Tag APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPGGGSGLNDIFEAQKIEWHEHHHHHHHH
1. Christopher T. Rankin, Maria-Concetta Veri, Sergey Gorlatov, Nadine Tuaillon, Steve Burke, Ling Huang, H. David Inzunza, Hua Li, Shannon Thomas, Syd Johnson, Jeffrey Stavenhagen, Scott Koenig, Ezio Bonvini: CD32B, the human inhibitory Fc-γ receptor IIB, as a target for monoclonal antibody therapy of B-cell lymphoma, Blood (2006) 108 (7): 2384-2391.
IgG Fc region receptors are members of the Ig superfamily that play roles in activating or inhibiting immune responses such as degranulation, phagocytosis, ADCC, cytokine release, and B-cell proliferation. There are three genes for human Fc γ RII /CD32 (A, B, and C) and one for mouse Fc γ RII B (CD32B). CD32 is a low affinity receptor for IgG. CD32B is expressed on B cells and myeloid dendritic cells. Ligation of CD32B on B cells downregulates antibody production and may, in some circumstances, promote apoptosis.
1μg (R: reducing conditions, N: non-reducing conditions).