Ile21-Gly161, with C-terminal 8*His ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGGGGSHHHHHHHH
1. Cell Signal . 2006 Jul;18(7):934-41. Epub 2006 Feb 9.
Frizzled-10 (FZD10), also known as CD350, is a G-protein coupled receptor with seven transmembrane domains. The 205 amino acid N-terminal extracellular region of Frizzled-10 contains a cysteine-rich domain that comprises the Wnt binding domain and mediates receptor oligomerization. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. Frizzled-10 is also up-regulated in several cancers and transformed cell lines. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and differentiation.
1μg (R: reducing conditions, N: non-reducing conditions).