Asn22-Ser319, with C-terminal 8*His NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSGGGSHHHHHHHH
55-95kDa
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
1． nature laboratory investigation pathobiology in focus article Published: 21 November 2016 CD68/macrosialin.
CD68 is a highly glycosylated glycoprotein, which has structural similarities with lysosome associated membrane protein (LAMP) and belongs to the LAMP family. Human CD68 contains 354 amino acids (aa), with a 21 aa signal sequence and a 298 aa extracellular domain (ECD), a 25 aa transmembrane domain, and a 10 aa cytoplasmic domain. CD68 is highly expressed by blood monocytes and tissue macrophages. CD68 plays a role in macrophage phagocytosis, intracellular lysosomal metabolism, extracellular cell-cell and cell-pathogen interactions. CD68 can be used alone or in combination with other cell markers of tumor-associated macrophages as a prognostic marker for cancer patient survival, showing good predictive value.
1μg (R: reducing conditions, N: non-reducing conditions).
您现在的位置：