Leu37-Arg286, with C-terminal 8*His
LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERHHHHHHHH
>95% by SDS-PAGE&RP-HPLC
Mesothelin (MSLN) is also known as CAK1 antigen, Pre-pro-megakaryocyte potentiating factor, which belongs to the mesothelin family. Mesothelin/MSLN can be proteolytically cleaved into the following two chains by a furin-like convertase: Megakaryocyte-potentiating factor (MPF) and the cleaved form of mesothelin. Both MPF and the cleaved form of mesothelin are N-glycosylated. Mesothelin/MSLN can interacts with MUC16. The membrane-anchored form of MSLN may play a role in cellular adhesion. MPF potentiates megakaryocyte colony formation in vitro.