LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGGSHHHHHHHHHH.
Within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.
Renin, also known as angiotensinogen enzyme, is a proteolytic enzyme released by paraspheroidal granulosa cells and is part of the renin-angiotensin system. Renin acts on plasma angiotensingen to produce inactive angiotensin I, which is hydrolyzed to active angiotensin II under the action of angiotensin converting enzyme. Angiotensin II can cause arteriolar vasoconstriction and promote the synthesis and secretion of aldosterone in adrenal cortex. Plasma Renin activity test can be used to diagnose primary aldosteronism and hypertension.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).
Immobilized Human Renin, His Tag at 2 μg/mL (50 μL/well) can bind Renin Recombinant Rabbit mAb (SDT-087-48) (S0B2149) with EC50 of 1.786-2.215 ng/ml.
您现在的位置：
