Protein sequence(O94907, Thr32-His266, with C-10*His) TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRHGGGGSHHHHHHHHHH
Theoretical: 27.4kDa Actual: 45kDa
12 months from date of receipt, -20 ℃ to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
DKK-1 is a member of the dickkopf family and is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the Wnt signaling pathway. DKK-1 is an antagonist of the Wnt/β-catenin signalling pathway that acts by isolating the LRP6 co-receptor so that it cannot aid in activating the WNT signaling pathway. Moreover, DKK-1 was demonstrated to antagonize the Wnt/β-catenin pathway via a reduction in β-catenin and an increase in OCT4 expression.This inhibition plays a key role in heart, head and forelimb development during anterior morphogenesis of the embryo. Elevated levels of DKK-1 in bone marrow, plasma and peripheral blood are associated with the presence of osteolytic bone lesions in patients with multiple myeloma. Due to the role of DKK-1 in inflammation induced bone loss DKK-1 is under investigation as target for therapeutic strategies in medicine and dentistry.
Immobilized Human DKK-1, His tag at 1 μg/mL (50 μL/well) can bind DKK-1 Recombinant Rabbit mAb (SDT-232-288) (Cat. No. S0B3276) with EC50 of 8.520-9.722 ng/ml.
您现在的位置：
