Protein sequence(Q80KX3, Gly2-Gly183, with C-10*His)
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGGGGGSHHHHHHHHHH
>95% by SDS-PAGE
12 months from date of receipt, -20 to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
M1R is the homolog of Vaccinia virus protein L1R. It has previously been shown that the product of the VV L1R is essential for the formation of intracellular mature virions and plays a role in virion morphogenesis. In the absense of L1R, only immature virion particles are formed and proteolytic cleavage of core proteins does not occur.