Protein sequence(Q80KX2, Val57-Thr181, with C-10*His)
VRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGGGGSHHHHHHHHHH
>95% by SDS-PAGE
12 months from date of receipt, -20 to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
Monkeypox A35R is a homolog of Vaccinia virus A33R protein. A33R is specifically incorporated into the viral outer envelope. The protein is expressed early and late after infection, cosistent with putative early and late promoter sequences. And it is necessay for efficient cell-to-cell spread.