VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALGGGGSHHHHHHHHHH.
19.0 kDa (reducing)
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Immobilized Human TNF-alpha, His Tag at 4 μg/mL (50 μL/well) can bind Biotinylated TNFR1/CD120a/TNFRSF1A His&Avi Tag, Human (Cat. No. UA010790) with EC50 of 8.596-12.17 ng/ml.