Thr20-Ser220, with C-terminal 8*His TGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISGGGSHHHHHHHH
1. Review Int J Mol Sci . 2010;11(12):5212-33. Epub 2010 Dec 17.
DMBT1(missing in malignant brain tumor 1), also known as glycoprotein 340 and salivary agglutinin, is a secreted protein that belongs to the DMBT1 family. DMBT1 is highly expressed in alveolar and macrophage tissues. In some macrophages, expression is visible on the membrane, while in other macrophages, it is strongly expressed in the phagosome/phagolysosomal chamber. It is expressed in the lungs, trachea, salivary glands, small intestine and stomach. In the pancreas, it is expressed in certain cells on the island of Langerhans. DMBT1 plays an important role in innate immune response.Recent studies identify DMBT1 as a high affinity ligand of Siglec-8 in human airways.
2μg (R: reducing conditions, N: non-reducing conditions).