Met1-Thr49, with C-terminal 10*His MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTGGGSGGGSHHHHHHHHHH
1. Gene ID: 608, updated on 18-Aug-2023.
B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is a type III membrane protein containing one extracellular cysteine rich domain. TNFRSF17 is expressed in mature B-cells, but not in T-cells or monocytes. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
2μg (R: reducing condition, N: non-reducing condition).