Protein sequence (P16871, Glu21-Asp239, with C-10*His) ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDGGGGSHHHHHHHHHH
12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.
Interleukin-7 receptor subunit alpha (IL7R-α) also known as CD127 (Cluster of Differentiation 127) is a protein that in humans is encoded by the IL7R gene. IL7R-α is a type I cytokine receptor and is a subunit of the functional Interleukin-7 receptor and Thymic Stromal Lymphopoietin (TSLP) receptors that plays an important role in lymphocyte differentiation, proliferation, and survival. IL-7 R alpha is expressed on double negative (CD44-/CD8+) and CD4+ or CD8+ single positive T cells as well as on CD8+ memory T cells and their precursors. It is expressed early in B cell development, prior to the appearance of surface IgM. IL-7 induces the downregulation and shedding of cell surface IL‑7 R alpha.IL-7 R alpha additionally associates with TSLP R to form the functional receptor for thymic stromal lymphopoietin.
Human CD127, His tag captured on CM5 Chip via anti-his antibody can bind IL-7, Human (Cat. No. UA040234) with an affinity constant of 4.67 nM as determined in SPR assay.
2μg（R: reducing conditions）
您现在的位置：
